PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000283.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 393aa    MW: 43440 Da    PI: 7.4944
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000283.1_g00018.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52171441128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              + pGfrFhPtdeelv +yLkkkv++k+l++ e ik++diyk++PwdLpk ++ +ekewyf+++rd+ky+++ r+nr+t +g+Wkat
  Itr_sc000283.1_g00018.1  17 MLPGFRFHPTDEELVGFYLKKKVQHKPLSI-ELIKQLDIYKYDPWDLPKLAAVGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKAT 101
                              579***************************.89***************8778899******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+d++++s+ +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  Itr_sc000283.1_g00018.1 102 GTDRPIYSSeTSKCIGLKKSLVFYKGRAARGIKTDWMMHEFRL 144
                              *******9866777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5713175IPR003441NAC domain
PROSITE profilePS5100556.70417175IPR003441NAC domain
PfamPF023651.9E-2519144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MDGRSSDQTE KIMDEVMLPG FRFHPTDEEL VGFYLKKKVQ HKPLSIELIK QLDIYKYDPW  60
DLPKLAAVGE KEWYFYCPRD RKYRNSARPN RVTGAGFWKA TGTDRPIYSS ETSKCIGLKK  120
SLVFYKGRAA RGIKTDWMMH EFRLPSISDI STPKRCLDKN IPPNDAWAIC RIFKKANSNA  180
QRALSHSWVV SSSPPTIPQT PTTTTTQQTL LTQNPNNLNQ VSMTTHDFKN SPEIMGLDLL  240
PYNDPSTSYT FPPSLFTHPH MPLQKPTIND ASSLLLDMSN SVFGEFVGKG SGESTVDYGG  300
LINDGFSVVG PENAVEGSLQ DGGSGGGGGA VVVVGPGKES SNIIDESIRF SFNGFPLNMG  360
AENAWKLSSL VWESSPCPSE ISSTSYSTSK CYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5281828171NO APICAL MERISTEM PROTEIN
1ut4_B3e-5281828171NO APICAL MERISTEM PROTEIN
1ut7_A3e-5281828171NO APICAL MERISTEM PROTEIN
1ut7_B3e-5281828171NO APICAL MERISTEM PROTEIN
3swm_A3e-52818211174NAC domain-containing protein 19
3swm_B3e-52818211174NAC domain-containing protein 19
3swm_C3e-52818211174NAC domain-containing protein 19
3swm_D3e-52818211174NAC domain-containing protein 19
3swp_A3e-52818211174NAC domain-containing protein 19
3swp_B3e-52818211174NAC domain-containing protein 19
3swp_C3e-52818211174NAC domain-containing protein 19
3swp_D3e-52818211174NAC domain-containing protein 19
4dul_A3e-5281828171NAC domain-containing protein 19
4dul_B3e-5281828171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151155TPKRC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016455718.11e-141PREDICTED: protein FEZ-like isoform X2
SwissprotQ9ZVH01e-104FEZ_ARATH; Protein FEZ
TrEMBLM1D3A91e-139M1D3A9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000803071e-138(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-103NAC family protein